Kasihilmar.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Kasih Ilmar
Description N/A
Keywords N/A
Server Information
WebSite kasihilmar favicon www.kasihilmar.com
Host IP 192.0.78.25
Location San Francisco, California, United States
Related Websites
Site Rank
mamakitchen-makcikmanggis.blogspot.com #8,690,571
sajionline.com.my #1,534,278
More to Explore
medicallaboratoriesbook.blogspot.com
zockerheim.de
4taraftarium24.com
lookerideas.net
adducation.info
skyscrapmetal.com.au
itau-unibanco.com
ausablevalleygrangefarmersmarkets.com
cooltech.in
themushroomcloud.co.nz
hugesexstream.com
iammissleading.com
Kasihilmar.com Valuation
US$2,388
Last updated: Feb 16, 2020

Kasihilmar.com has global traffic rank of 21,018,597. Kasihilmar.com has an estimated worth of US$ 2,388, based on its estimated Ads revenue. Kasihilmar.com receives approximately 145 unique visitors each day. Its web server is located in San Francisco, California, United States, with IP address 192.0.78.25. According to SiteAdvisor, kasihilmar.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,388
Daily Ads Revenue US$1
Monthly Ads Revenue US$39
Yearly Ads Revenue US$477
Daily Unique Visitors 145
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 21,018,597
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
kasihilmar.com A 299 IP: 192.0.78.25
kasihilmar.com A 299 IP: 192.0.78.24
kasihilmar.com NS 21599 Target: ns3.wordpress.com.
kasihilmar.com NS 21599 Target: ns2.wordpress.com.
kasihilmar.com NS 21599 Target: ns1.wordpress.com.
kasihilmar.com SOA 21599 MNAME: ns1.wordpress.com.
RNAME: hostmaster.wordpress.com.
Serial: 2005071858
Refresh: 14400
Retry: 7200
Expire: 604800
Minimum TTL: 300
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Sun, 16 Feb 2020 01:48:24 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://kasihilmar.com/
X-ac: 3.ewr _dca 

HTTP/2 200 
server: nginx
date: Sun, 16 Feb 2020 01:48:24 GMT
content-type: text/html; charset=UTF-8
strict-transport-security: max-age=86400
vary: Accept-Encoding
vary: Cookie
x-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
link: <https://wp.me/2qC9R>; rel=shortlink
x-ac: 3.ewr _dca 

Kasihilmar.com Whois Information
   Domain Name: KASIHILMAR.COM
   Registry Domain ID: 1759043725_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.wildwestdomains.com
   Registrar URL: http://www.wildwestdomains.com
   Updated Date: 2020-01-24T14:29:10Z
   Creation Date: 2012-11-13T12:57:35Z
   Registry Expiry Date: 2020-11-13T12:57:35Z
   Registrar: Wild West Domains, LLC
   Registrar IANA ID: 440
   Registrar Abuse Contact Email: abuse@wildwestdomains.com
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS1.WORDPRESS.COM
   Name Server: NS2.WORDPRESS.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: KASIHILMAR.COM
Registry Domain ID: 1759043725_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.wildwestdomains.com
Registrar URL: http://www.wildwestdomains.com
Updated Date: 2019-10-13T11:38:17Z
Creation Date: 2012-11-13T12:57:35Z
Registrar Registration Expiration Date: 2020-11-13T12:57:35Z
Registrar: Wild West Domains, LLC
Registrar IANA ID: 440
Registrar Abuse Contact Email: abuse@wildwestdomains.com
Registrar Abuse Contact Phone: +1.4806242505
Reseller: WordPress.com
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext: 
Registrant Fax: +1.4806242598
Registrant Fax Ext: 
Registrant Email: KASIHILMAR.COM@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext: 
Admin Fax: +1.4806242598
Admin Fax Ext: 
Admin Email: KASIHILMAR.COM@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext: 
Tech Fax: +1.4806242598
Tech Fax Ext: 
Tech Email: KASIHILMAR.COM@domainsbyproxy.com
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/